Candidatus Formimonas warabiya: DCMF_06130 Help Entry DCMF_06130        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa00720   Other carbon fixation pathways fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_06130   09102 Energy metabolism    00720 Other carbon fixation pathways     DCMF_06130 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_06130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_9 Fer4_7 Fer4_21 Fer4_13 LdpA_Fe-S-bd Fer4_4 Fer4_16 Fer4_17 TNFR_c6 Fer4_15 Fer4_3 DUF678 Motif Other DBs NCBI-ProteinID:  ATW24418 UniProt:  A0A3G1KPQ1 LinkDB All DBs Position complement(1295726..1295920) Genome browser AA seq 64 aa AA seqDB search MKKYSVSVNEKYCKACGICIGLCPKGVYQENYLGKALVEDADKCTGCRICELHCPDFCLQ VGEK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatacagcgtcagtgtcaatgaaaagtattgtaaagcttgcggcatctgcatc ggattatgccccaaaggcgtgtatcaggaaaattatttggggaaagccctggtcgaagat gcagacaaatgtaccggatgtagaatttgcgaacttcactgtcccgatttttgtctccag gtaggtgaaaaataa

DBGET integrated database retrieval system