Candidatus Formimonas warabiya: DCMF_09685 Help Entry DCMF_09685        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa00720   Other carbon fixation pathways fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_09685   09102 Energy metabolism    00720 Other carbon fixation pathways     DCMF_09685 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_09685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_9 Fer4_2 Fer4_7 Fer4_21 Fer4_6 Fer4_16 Fer4_15 Fer4_13 Fer4_8 LdpA_Fe-S-bd Fer4_17 Fer4_4 Motif Other DBs NCBI-ProteinID:  ATW25012 UniProt:  A0A3G1KRA7 LinkDB All DBs Position complement(2078249..2078452) Genome browser AA seq 67 aa AA seqDB search MKKYSVSVNEKHCKACGICIGLCPKGVFRENYLGKAVVEEADKCAGCKICALHCPDFCIE VGEDHDR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagtacagtgtcagtgtcaacgaaaaacactgtaaagcgtgcggtatctgtatc gggttgtgccccaaaggagtattccgggaaaactatctgggcaaagccgtagtagaagag gcggacaaatgtgcgggctgtaaaatctgcgccctccattgccccgacttttgcattgag gtaggtgaagatcatgaccggtaa

DBGET integrated database retrieval system