Candidatus Formimonas warabiya: DCMF_10365 Help Entry DCMF_10365        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa00720   Other carbon fixation pathways fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_10365   09102 Energy metabolism    00720 Other carbon fixation pathways     DCMF_10365 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_10365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_10 Fer4_2 Fer4_9 Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_16 Fer4_17 Fer4_8 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  ATW28518 UniProt:  A0A3G1L1K8 LinkDB All DBs Position complement(2219786..2219983) Genome browser AA seq 65 aa AA seqDB search MEKKYIVHLTDRYCKACGICIGLCPKGVFTENYLGKAVIDHMDSCTGCKMCQFHCPDFCL EVAEA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaaaatatatcgttcatctcacggatcgttattgcaaagcctgcgggatctgt atcgggctctgccccaaaggtgtttttacagaaaattatttaggcaaagcagtgattgat catatggactcgtgcaccggctgtaagatgtgccagttccattgccctgatttttgcctg gaggtggcagaagcatga

DBGET integrated database retrieval system