Candidatus Formimonas warabiya: DCMF_25645 Help Entry DCMF_25645        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K01661   naphthoate synthase [EC:4.1.3.36] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00130   Ubiquinone and other terpenoid-quinone biosynthesis fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00130 Ubiquinone and other terpenoid-quinone biosynthesis     DCMF_25645 Enzymes [BR:fwa01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.3  Oxo-acid-lyases     4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase      DCMF_25645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ECH_1 DJC28_CD Motif Other DBs NCBI-ProteinID:  ATW27688 UniProt:  A0A3G1KYX3 LinkDB All DBs Position 5670987..5671253 Genome browser AA seq 88 aa AA seqDB search MMFLGEYMDAEEGHRLGLVNRVVPREKLVDETLAMAQKIAKISPEALQMQKELINHTMRR RTLKALLHTVWRCLTWPGCVRPPSSGIR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgatgtttctcggtgagtacatggatgctgaggagggccaccgactaggtctggtgaac cgggtggtaccccgggagaagttagtagacgagacactggccatggcccaaaagattgcc aagatctcgcccgaggctctgcaaatgcaaaaggaactgatcaaccacactatgaggcgc agaactttaaaagctctgttgcatacggtatggagatgtttaacatggcctggatgtgtg agacctccgagttccgggattcggtaa

DBGET integrated database retrieval system