Fuscovulum ytuae: QF092_12870 Help Entry QF092_12870       CDS       T09905                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism fyt  Fuscovulum ytuae Brite KEGG Orthology (KO) [BR:fyt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fyt03036]     QF092_12870    03400 DNA repair and recombination proteins [BR:fyt03400]     QF092_12870 Chromosome and associated proteins [BR:fyt03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     QF092_12870 DNA repair and recombination proteins [BR:fyt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       QF092_12870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS K-box PspAA ACDH-11_C DUF3829 SUS_EPBD Motif Other DBs NCBI-ProteinID:  WGV15165 UniProt:  A0ABY8Q4G7 LinkDB All DBs Position complement(2674892..2675206) Genome browser AA seq 104 aa AA seqDB search MTIDLNSLSLKELKELQGQVTRAIANFEDRKKKQALAELEEKAREMGYSLAELTGTSAAR KRAPATAKFANPANPADTWSGRGRKPRWFAEALAAGKKPEEMAV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaccatcgatctcaattcgctttccctcaaggaactcaaggaacttcagggacaagtg acccgtgctatcgcgaatttcgaagaccgcaagaaaaaacaagctctcgccgaacttgaa gaaaaagcacgcgaaatgggctattctctggcggaactgacgggcacatcggccgccagg aaacgcgcgcctgctaccgcaaaattcgctaatcctgccaatcccgccgatacttggtcg ggccgtggccgcaaaccccgctggtttgcagaggcgcttgccgctggaaaaaaaccggaa gaaatggccgtctga

DBGET integrated database retrieval system