Gossypium arboreum (tree cotton): 108459225 Help Entry 108459225         CDS       T05776                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism gab  Gossypium arboreum (tree cotton) Pathway gab03083   Polycomb repressive complex gab04120   Ubiquitin mediated proteolysis gab04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108459225    04120 Ubiquitin mediated proteolysis     108459225   09126 Chromosome    03083 Polycomb repressive complex     108459225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gab04131]     108459225    04121 Ubiquitin system [BR:gab04121]     108459225    03036 Chromosome and associated proteins [BR:gab03036]     108459225 Membrane trafficking [BR:gab04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     108459225 Ubiquitin system [BR:gab04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      108459225    Cul7 complex      108459225 Chromosome and associated proteins [BR:gab03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      108459225   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      108459225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  108459225 NCBI-ProteinID:  XP_017614065 UniProt:  A0A0B0PJ28 LinkDB All DBs Position 2:complement(377956..380130) Genome browser AA seq 156 aa AA seqDB search MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY CKKHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcggggaggaagatcacccttaagagctcggacggcgaatcattcgaggtt gatgaagcggtggcgttggagtcgcagacgattaagcatatgatcgaggacgattgcgct gataacgggataccgttgcctaatgttacgagcaagatcttagcgaaggtgatcgagtac tgcaagaaacacgtcgaggctcctaagacagacgatcgatccgccgatgacgagctcaag agttgggacgctgactttgtcaaggtcgatcaagctactctctttgatctcattctggca gcgaactatttgaacatcaagggcttgctggatctcacttgccaaactgttgctgacatg atcaagggaaagaccccagaagagatcaggaagactttcaatatcaagaatgacttcacc ccggaagaggaagaagaggttcgtcgggagaaccagtgggcattcgaatga

DBGET integrated database retrieval system