Gossypium arboreum (tree cotton): 108460519 Help Entry 108460519         CDS       T05776                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gab  Gossypium arboreum (tree cotton) Pathway gab04145   Phagosome gab04148   Efferocytosis gab04620   Toll-like receptor signaling pathway gab05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gab00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108460519    04148 Efferocytosis     108460519  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108460519  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108460519  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gab04131]     108460519   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gab04147]     108460519    04031 GTP-binding proteins [BR:gab04031]     108460519 Membrane trafficking [BR:gab04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108460519  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108460519   Macropinocytosis    Ras GTPases     108460519  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108460519 Exosome [BR:gab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108460519   Exosomal proteins of other body fluids (saliva and urine)    108460519   Exosomal proteins of colorectal cancer cells    108460519   Exosomal proteins of bladder cancer cells    108460519 GTP-binding proteins [BR:gab04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108460519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf B12-binding Motif Other DBs NCBI-GeneID:  108460519 NCBI-ProteinID:  XP_017615522 LinkDB All DBs Position 6:143233537..143235680 Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVTKKWIPELKHYAPGVPIVLVGTKL DLRDDQQFFVDHPGAVPISTAQGEELRKQVGSSAYIECSSKTQQNVKAVFDSAIKVVLQP PKKSKKKKAHGGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccagattcataaagtgtgttactgtcggcgatggtgctgtcggcaaaact tgcttgcttatttcctacaccagcaacactttccctacggattatgtccctactgttttc gacaatttcagtgcaaatgttgttgtggatggcagcactgtcaacttaggtttatgggat actgctggtcaagaggattacaatagattgagaccattaagctatcgtggggccgatgtc tttattcttgcattttccctcattagcaaggctagttacgaaaatgttacaaagaagtgg attcctgaattaaagcattatgcacctggtgttccgatagttcttgttggaactaagctt gatctccgggatgatcagcaattctttgtagaccatcctggcgcagtgcccatttctaca gctcagggtgaagaattaaggaaacaggtagggtcctctgcctacatcgagtgtagttca aaaacacagcagaatgtgaaggcagtttttgattcagctattaaggtagtgcttcagcct ccgaagaaaagcaagaagaaaaaggcacatggtggttgctcaatattgtga

DBGET integrated database retrieval system