Gossypium arboreum (tree cotton): 108460734 Help Entry 108460734         CDS       T05776                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism gab  Gossypium arboreum (tree cotton) Pathway gab03083   Polycomb repressive complex gab04120   Ubiquitin mediated proteolysis gab04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108460734    04120 Ubiquitin mediated proteolysis     108460734   09126 Chromosome    03083 Polycomb repressive complex     108460734  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gab04131]     108460734    04121 Ubiquitin system [BR:gab04121]     108460734    03036 Chromosome and associated proteins [BR:gab03036]     108460734 Membrane trafficking [BR:gab04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     108460734 Ubiquitin system [BR:gab04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      108460734    Cul7 complex      108460734 Chromosome and associated proteins [BR:gab03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      108460734   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      108460734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  108460734 NCBI-ProteinID:  XP_017615845 UniProt:  A0A0B0Q2K7 LinkDB All DBs Position 2:102765605..102766773 Genome browser AA seq 156 aa AA seqDB search MASTSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEY CKKHVDAAADKEKTPDDELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgacttcgaggaagataatgttgaggagctccgacggagagacttttgaggtg gaggaagcggtggcggttgagtcgcagacgatcaagcacatgatcgaggacgattgcgcc gacaacgagatccctctcccaaacgtcaccagcaagatcttgtccaaggtccttgagtac tgcaagaagcatgtcgatgctgctgccgacaaggaaaagactcctgatgacgaactcaag gtttgggatgctgattttgtcaaggttgaccaaaataccctctttgatctcatcctggca gcgaactatctgaatatcaagagcttgctggacttgacctgccaaactgtggctgatatg ataaagggaaagacacccgaggagattcgcaagaccttcaacatcaagaacgatttcacc cccgaggaagaagaggaggttaggagggagaatcaatgggcattcgagtga

DBGET integrated database retrieval system