Gossypium arboreum (tree cotton): 108468962 Help Entry 108468962         CDS       T05776                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism gab  Gossypium arboreum (tree cotton) Brite KEGG Orthology (KO) [BR:gab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:gab03041]     108468962   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gab04052]     108468962 Spliceosome [BR:gab03041]  Complex B   Other components    Complex B specific factors     108468962 Cytokines and neuropeptides [BR:gab04052]  Neuropeptides   Unclassified    108468962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  108468962 NCBI-ProteinID:  XP_017625321 LinkDB All DBs Position 8:complement(6668827..6670347) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtagtgttgaacgacaggctggggaagaaggtgagggtgaagtgcaacgag gacgacaccatcggcgacctcaagaagctggttgctgctcagactggaacccgagccgat aagattcgaatccagaagtggtacaccatctacaaggaccatatcaccctcaaagactac gagattcacgatggcatgggcctcgagctctattacaactaa

DBGET integrated database retrieval system