Gossypium arboreum (tree cotton): 108474931 Help Entry 108474931         CDS       T05776                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism gab  Gossypium arboreum (tree cotton) Pathway gab04144   Endocytosis gab04145   Phagosome gab04148   Efferocytosis Brite KEGG Orthology (KO) [BR:gab00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108474931    04145 Phagosome     108474931    04148 Efferocytosis     108474931  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gab04131]     108474931   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gab04147]     108474931    04031 GTP-binding proteins [BR:gab04031]     108474931 Membrane trafficking [BR:gab04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108474931 Exosome [BR:gab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108474931   Exosomal proteins of other body fluids (saliva and urine)    108474931   Exosomal proteins of colorectal cancer cells    108474931   Exosomal proteins of bladder cancer cells    108474931 GTP-binding proteins [BR:gab04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108474931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Gtr1_RagA Motif Other DBs NCBI-GeneID:  108474931 NCBI-ProteinID:  XP_017632451 LinkDB All DBs Position 3:1858408..1862569 Genome browser AA seq 168 aa AA seqDB search MSQLGEADVIFSSGREVSAFWVGKTCLMNQYVNKKFSNQYKATIGADFLTKQVQLEIWDT AGQERFQSLDVAFYPGAECCLLVYDVNSMKSIENLNNCREEFLIQIYILNTENFPFVVLG NKIDVDVEIVSEKKAPAWCASKGNIPYFKTSAKEGVKGPSMVEEEMLS NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgtcgcaactgggtgaagctgatgtcatcttttcttcaggaagagaagtttcggcattt tgggtagggaagacgtgtttgatgaatcaatatgtaaataagaagtttagcaatcagtat aaggcgacgattggagctgattttttgacaaagcaagtgcagcttgagatctgggacaca gctggccaggaaagattccagagcctagacgttgctttctatcccggtgctgaatgttgt cttcttgtttatgatgtcaactcaatgaaatcgattgaaaaccttaacaactgtagagaa gaattccttattcagatatatattctgaacactgagaatttcccgtttgttgttttggga aacaaaatcgatgttgatgttgaaatagtgtctgagaaaaaggccccagcatggtgtgcc tcgaaaggaaatatcccctatttcaagacatctgccaaggaaggagttaaaggccccagc atggtggaggaagagatgttaagttaa

DBGET integrated database retrieval system