Gossypium arboreum (tree cotton): 108484561 Help Entry 108484561         CDS       T05776                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism gab  Gossypium arboreum (tree cotton) Brite KEGG Orthology (KO) [BR:gab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:gab03041]     108484561   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gab04052]     108484561 Spliceosome [BR:gab03041]  Complex B   Other components    Complex B specific factors     108484561 Cytokines and neuropeptides [BR:gab04052]  Neuropeptides   Unclassified    108484561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  108484561 NCBI-ProteinID:  XP_017643870 LinkDB All DBs Position 6:complement(7079286..7079740) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtattgaacgaccggctagggaagaaggtgcgcgtgaagtgcaacgac gacgacacgatcggagatcttaagaagctggtcgcggcccaaactggaactcgggccgac aagatccgtatccagaagtggtatacggtttacaaggatcatattaccctcaaagattac gagatccacgacggtatgggcctcgagctttactacaattaa

DBGET integrated database retrieval system