Glycocaulis abyssi: AB6B38_03070
Help
Entry
AB6B38_03070 CDS
T10778
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
gaby Glycocaulis abyssi
Brite
KEGG Orthology (KO) [BR:
gaby00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
AB6B38_03070 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
NP_C_Orthomyx
Motif
Other DBs
NCBI-ProteinID:
XER18673
LinkDB
All DBs
Position
608786..609145
Genome browser
AA seq
119 aa
AA seq
DB search
MTDPRKPSGPKGPSAPGPGDTERQTGITVKTRPRTERPSMYKVLLLNDDFTPMEFVIQVL
MVIFHKDQEDATRIMLHVHQNGVGVCGVFTYEVAETKVAQVMDAARRAQHPLQCTMEKD
NT seq
360 nt
NT seq
+upstream
nt +downstream
nt
atgacggacccgcgcaaaccatcgggaccaaaggggccgtcggcgccgggaccgggcgac
acggagcgccagacgggcattaccgtgaaaacgcgcccgcgtaccgagcgcccgtccatg
tacaaggtcttgctgctcaatgacgactttacgccgatggaattcgtcattcaggttctg
atggtgatttttcacaaggaccaggaagacgcgactcgcatcatgctgcatgttcaccag
aatggggtgggggtttgcggcgtttttacctacgaggtagctgagaccaaggtggcgcaa
gttatggacgcggcacgccgggcacagcatcctctccagtgcaccatggaaaaggactag
DBGET
integrated database retrieval system