Geoglobus acetivorans: GACE_0911 Help Entry GACE_0911         CDS       T03507                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism gac  Geoglobus acetivorans Pathway gac03010   Ribosome Brite KEGG Orthology (KO) [BR:gac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GACE_0911   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GACE_0911  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:gac03011]     GACE_0911    04121 Ubiquitin system [BR:gac04121]     GACE_0911   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gac04147]     GACE_0911 Ribosome [BR:gac03011]  Ribosomal proteins   Eukaryotes    Small subunit     GACE_0911   Archaea     GACE_0911 Ubiquitin system [BR:gac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GACE_0911 Exosome [BR:gac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GACE_0911   Exosomal proteins of colorectal cancer cells    GACE_0911 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_Ribbon_1 Zn_ribbon_RPB9 IBR Zn_ribbon_Nudix Zn_ribbon_NrdR Zn_ribbon_11 MqsA_antitoxin DUF1451 DZR_2 DZR Cas12f1-like_TNB Zn_ribbon_NUD GFA Lar_restr_allev Zn_ribbon_IS1595 Zn_ribbon_NOB1 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  AIY89958 UniProt:  A0A0A7GDP5 LinkDB All DBs Position complement(756981..757160) Genome browser AA seq 59 aa AA seqDB search MAKGGSNKGEVLVSKFYEVKGDKVVRTRKFCPRCGEGVFLAEHKDRRTCGKCGYTEFKK NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggtggatccaataagggagaggttctggtgtcaaaattctatgaggtcaag ggagacaaggttgtcaggacgagaaagttctgtccgaggtgcggagagggagttttcctg gcggagcacaaggacagaaggacatgcggtaagtgtggatatactgaattcaagaaatga

DBGET integrated database retrieval system