Geoglobus acetivorans: GACE_1744 Help Entry GACE_1744         CDS       T03507                                  Name (GenBank) Archaeal histone   KO K24450   DNA-binding protein Organism gac  Geoglobus acetivorans Brite KEGG Orthology (KO) [BR:gac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gac03036]     GACE_1744 Chromosome and associated proteins [BR:gac03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     GACE_1744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TFIID-31kDa CENP-T_C Bromo_TP CENP-S TFIID_20kDa TAF TFIID-18kDa DUF1931 TIP49_C Motif Other DBs NCBI-ProteinID:  AIY90774 UniProt:  A0A0A7GFH1 LinkDB All DBs Position 1443457..1443660 Genome browser AA seq 67 aa AA seqDB search MAELPLAPIDRLIRKAGAERVSEDAVEKMAEVLEEYALQVAKKAVEIAKHANRKTVKAED IKLALSM NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccacttgccccaatcgacagattgataagaaaggctggtgctgagaga gttagcgaggatgcagtagaaaagatggctgaggtccttgaagaatacgcacttcaggtt gcaaagaaagcagtcgaaattgcaaagcacgcaaacagaaagactgtcaaggcagaggac atcaagcttgctctcagcatgtaa

DBGET integrated database retrieval system