Gymnodraco acuticeps: 117537128 Help Entry 117537128         CDS       T09661                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism gacu  Gymnodraco acuticeps Pathway gacu04010   MAPK signaling pathway gacu04137   Mitophagy - animal gacu04140   Autophagy - animal gacu04218   Cellular senescence gacu04371   Apelin signaling pathway gacu04625   C-type lectin receptor signaling pathway gacu04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117537128 (rras)    04371 Apelin signaling pathway     117537128 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117537128 (rras)    04137 Mitophagy - animal     117537128 (rras)   09143 Cell growth and death    04218 Cellular senescence     117537128 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117537128 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117537128 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gacu04147]     117537128 (rras)    04031 GTP-binding proteins [BR:gacu04031]     117537128 (rras) Exosome [BR:gacu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117537128 (rras)   Exosomal proteins of bladder cancer cells    117537128 (rras) GTP-binding proteins [BR:gacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117537128 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  117537128 NCBI-ProteinID:  XP_034058167 UniProt:  A0A6P8TM90 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVGGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEHQRVISREDAQAFTRENRIHYMEASAKNRHNVDECFLELVQIIRKFQEMESPPPQ AHHTGKKKSGDCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcagaagaagaacgattcaaactggttgtggtgggtgggggcggggtggggaag agcgccctcaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatt gaggactcctacaccaagatctgcaccgttggggggaaggagacccggctggacatcctg gatacagccggtcaggaggagtttggagcgatgagggagcagtacatgcgctcaggagaa ggctttctattggtgtttgcactcaacgaccggggcagctaccacgaggttcagaagttc cacacgcagatcctgagagtgaaggaccgggatgacttccccatggtgctggttggaaac aaggcggacctggagcatcagagagtgatctccagggaggatgcccaggcgttcaccaga gagaacaggatccactacatggaggcttctgccaagaatcgccacaacgtggatgaatgc ttcttggagctggtacaaattatcagaaagtttcaggagatggagagtcctcccccccaa gctcatcacacagggaaaaagaagagcggggactgtccctgtgtcctgctctga

DBGET integrated database retrieval system