Gymnodraco acuticeps: 117537128 Help Entry 117537128         CDS       T09661                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism gacu  Gymnodraco acuticeps Pathway gacu04010   MAPK signaling pathway gacu04137   Mitophagy - animal gacu04140   Autophagy - animal gacu04218   Cellular senescence gacu04371   Apelin signaling pathway gacu04519   Cadherin signaling gacu04625   C-type lectin receptor signaling pathway gacu04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117537128 (rras)    04371 Apelin signaling pathway     117537128 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     117537128 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117537128 (rras)    04137 Mitophagy - animal     117537128 (rras)   09143 Cell growth and death    04218 Cellular senescence     117537128 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117537128 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117537128 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gacu04147]     117537128 (rras)    04031 GTP-binding proteins [BR:gacu04031]     117537128 (rras) Exosome [BR:gacu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117537128 (rras)   Exosomal proteins of bladder cancer cells    117537128 (rras) GTP-binding proteins [BR:gacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117537128 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  117537128 NCBI-ProteinID:  XP_034058167 UniProt:  A0A6P8TM90 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVGGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEHQRVISREDAQAFTRENRIHYMEASAKNRHNVDECFLELVQIIRKFQEMESPPPQ AHHTGKKKSGDCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcagaagaagaacgattcaaactggttgtggtgggtgggggcggggtggggaag agcgccctcaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatt gaggactcctacaccaagatctgcaccgttggggggaaggagacccggctggacatcctg gatacagccggtcaggaggagtttggagcgatgagggagcagtacatgcgctcaggagaa ggctttctattggtgtttgcactcaacgaccggggcagctaccacgaggttcagaagttc cacacgcagatcctgagagtgaaggaccgggatgacttccccatggtgctggttggaaac aaggcggacctggagcatcagagagtgatctccagggaggatgcccaggcgttcaccaga gagaacaggatccactacatggaggcttctgccaagaatcgccacaacgtggatgaatgc ttcttggagctggtacaaattatcagaaagtttcaggagatggagagtcctcccccccaa gctcatcacacagggaaaaagaagagcggggactgtccctgtgtcctgctctga

DBGET integrated database retrieval system