Gymnodraco acuticeps: 117538600 Help Entry 117538600         CDS       T09661                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism gacu  Gymnodraco acuticeps Pathway gacu03082   ATP-dependent chromatin remodeling gacu04217   Necroptosis Brite KEGG Orthology (KO) [BR:gacu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117538600  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     117538600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gacu03036]     117538600   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gacu04147]     117538600 Chromosome and associated proteins [BR:gacu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117538600 Exosome [BR:gacu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117538600 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  117538600 NCBI-ProteinID:  XP_034060347 UniProt:  A0A6P8TX29 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MTVHTPEERPEPRLRPAPPGPGVTHLRKGNYTHRVGAGAPVYLTAEILELAGNAARDNKK TRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAAKK NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgactgttcacacaccggaggaaaggcccgagccaaggctaagacccgctcctcccggg ccgggagttacccatctgaggaagggtaactacacccaccgtgtcggtgccggagccccg gtgtacctgaccgctgagatcctggagctggctggaaacgccgcccgggacaacaagaag acccggatcatcccccgccacctgcagctcgccgtccgcaacgacgaggagctgaacaag ctgctgggaggagtgaccatcgctcagggaggcgtgctgcccaacatccaggctgtgctg ctgcccaagaagaccgagaaggccgccaagaagtga

DBGET integrated database retrieval system