Gymnodraco acuticeps: 117542816 Help Entry 117542816         CDS       T09661                                  Name (RefSeq) metallothionein A   KO K14739   metallothionein 1/2 Organism gacu  Gymnodraco acuticeps Brite KEGG Orthology (KO) [BR:gacu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gacu03019]     117542816    03029 Mitochondrial biogenesis [BR:gacu03029]     117542816 Messenger RNA biogenesis [BR:gacu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      117542816 Mitochondrial biogenesis [BR:gacu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     117542816 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  117542816 NCBI-ProteinID:  XP_034066561 UniProt:  A0A6P8TQN4 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGGSCTCTNCSCKSCKKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccttgcgactgctccaagagtggaacctgcaactgcggaggatcctgcacttgc acaaactgctcctgcaaaagctgcaagaagagctgctgcccatgctgcccatccggctgc accaaatgcgcctctggctgcgtgtgcaaagggaagacttgtgacacaagctgctgtcag tga

DBGET integrated database retrieval system