Gymnodraco acuticeps: 117545034 Help Entry 117545034         CDS       T09661                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism gacu  Gymnodraco acuticeps Pathway gacu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gacu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117545034  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gacu04121]     117545034    03400 DNA repair and recombination proteins [BR:gacu03400]     117545034 Ubiquitin system [BR:gacu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117545034    Cul5 complex      117545034 DNA repair and recombination proteins [BR:gacu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117545034 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  117545034 NCBI-ProteinID:  XP_034070574 UniProt:  A0A6P8U1H9 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcaaaagaccacaatcttcaccgatgccaaggag tccaccactgtgtatgagctgaagcgtattgttgaaggaattcttaagagaccaccagag gaccagaggctgtacaaagatgatcagtcgctagaggacagtaaaactcttggtgactgt ggattcaccaaccagactgccagacctcaagccccagctacagttggtctggccttccgc ataaatgatgagatgttcgagcagctgcacgtcgaggccttctccagccccccagaactc cccgatgtgatgaagccccaggactccggtagcacggctaacgaacaggcggtgcagtga

DBGET integrated database retrieval system