Gymnodraco acuticeps: 117545246 Help Entry 117545246         CDS       T09661                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism gacu  Gymnodraco acuticeps Pathway gacu04010   MAPK signaling pathway gacu04068   FoxO signaling pathway gacu04081   Hormone signaling gacu04114   Oocyte meiosis gacu04140   Autophagy - animal gacu04150   mTOR signaling pathway gacu04810   Regulation of actin cytoskeleton gacu04910   Insulin signaling pathway gacu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:gacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117545246    04068 FoxO signaling pathway     117545246    04150 mTOR signaling pathway     117545246   09133 Signaling molecules and interaction    04081 Hormone signaling     117545246  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117545246   09143 Cell growth and death    04114 Oocyte meiosis     117545246   09142 Cell motility    04810 Regulation of actin cytoskeleton     117545246  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     117545246    04914 Progesterone-mediated oocyte maturation     117545246  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gacu04052]     117545246 Cytokines and neuropeptides [BR:gacu04052]  Neuropeptides   Unclassified    117545246 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Peptidase_S68 Motif Other DBs NCBI-GeneID:  117545246 NCBI-ProteinID:  XP_034070868 UniProt:  A0A6P8U2F7 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MASVPYAVSMLLLLALYSRGVSSAPALHLCGSHLADALYLVCGELGFFYSPNRPHKRDLE DMLGFLSKREQRPRRANSGHKETKVKRGIVEQCCYKPCSVYHLEGYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctagtgtaccatatgcagtgtccatgctgctactgctggcactctactctcggggg gtgtcctctgctccagccctccacctgtgcggctcccacctggcggacgccctctacttg gtatgtggggagctgggctttttctacagtccaaaccgacctcataagcgagatctggaa gacatgctcgggttcctgtctaaaagggagcagcggccgcggagggctaattctggccac aaggagacgaaggtgaagagaggcatcgtggagcagtgctgctataagccgtgcagcgtt taccacctggagggctactgcaactga

DBGET integrated database retrieval system