Gymnodraco acuticeps: 117551817 Help Entry 117551817         CDS       T09661                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism gacu  Gymnodraco acuticeps Pathway gacu04010   MAPK signaling pathway gacu04144   Endocytosis gacu04370   VEGF signaling pathway gacu04510   Focal adhesion gacu04517   IgSF CAM signaling gacu04518   Integrin signaling gacu04520   Adherens junction gacu04530   Tight junction gacu04810   Regulation of actin cytoskeleton gacu04912   GnRH signaling pathway gacu05100   Bacterial invasion of epithelial cells gacu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117551817 (cdc42l)    04370 VEGF signaling pathway     117551817 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117551817 (cdc42l)    04518 Integrin signaling     117551817 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117551817 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117551817 (cdc42l)    04520 Adherens junction     117551817 (cdc42l)    04530 Tight junction     117551817 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117551817 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     117551817 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117551817 (cdc42l)    05100 Bacterial invasion of epithelial cells     117551817 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gacu04131]     117551817 (cdc42l)    03036 Chromosome and associated proteins [BR:gacu03036]     117551817 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gacu04147]     117551817 (cdc42l)    04031 GTP-binding proteins [BR:gacu04031]     117551817 (cdc42l) Membrane trafficking [BR:gacu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117551817 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     117551817 (cdc42l)   Macropinocytosis    Ras GTPases     117551817 (cdc42l) Chromosome and associated proteins [BR:gacu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     117551817 (cdc42l) Exosome [BR:gacu04147]  Exosomal proteins   Exosomal proteins of microglial cells    117551817 (cdc42l)   Exosomal proteins of breast milk    117551817 (cdc42l) GTP-binding proteins [BR:gacu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117551817 (cdc42l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  117551817 NCBI-ProteinID:  XP_034080765 UniProt:  A0A6P8V5L9 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLICFSSVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLYPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaagtgtgtagtggtaggggacggcgctgtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcccacggttttcgacaattat gcagtgacggtgatgatcgggggagagccctatacactcggattatttgatacagcaggc caggaggactacgaccggctgcgtccgctcagctatcctcagactgacgtgttcctcata tgtttctccagcgtctccccctcgtcatttgaaaacgtcaaagagaagtgggttcctgag atttctcaccactgcccgcgcacccccttcctgttagtgggcacgcaggtggatctgcgg gaagacagcaacaccatcgagaagctggcgaagaacaagcagcgcccgctatatcctgag agcggagagaagctggcgcgggagctgaaggccgtcaaatacgtggagtgctctgctctc acacagcgagggctgaagaatgtgtttgacgaggccatcctggccgccctggagcctcct gagaccaaaaccaagagaaagtgcgtccttctatag

DBGET integrated database retrieval system