Gymnodraco acuticeps: 117561413 Help Entry 117561413         CDS       T09661                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism gacu  Gymnodraco acuticeps Pathway gacu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gacu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117561413  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gacu04121]     117561413    03400 DNA repair and recombination proteins [BR:gacu03400]     117561413 Ubiquitin system [BR:gacu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117561413    Cul5 complex      117561413 DNA repair and recombination proteins [BR:gacu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117561413 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  117561413 NCBI-ProteinID:  XP_034094708 UniProt:  A0A6P8W784 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEERTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacggagaagagagaacctacggtggctgtgaagggccagatgccatgtacgtgaag ctgatctcttcggatggccacgagtttatcgtgaaacgggaacacgccttaacatccggg acgatcaaagccatgttgagcggacctggtcagtttgctgagaacgaaaccaacgaggtg aacttcagggagatcccgtctcacgtgctctccaaggtctgcatgtacttcacctacaag gtccgctacaccaacagctccacggaaatcccagaattccccatcgctccggagatcgcg ctggaactgctcatggctgcaaactttttggattgctaa

DBGET integrated database retrieval system