Gigantopelta aegis (peltospirid snail): 121368011 Help Entry 121368011         CDS       T07458                                  Name (RefSeq) elongin-B-like isoform X1   KO K03873   elongin-B Organism gae  Gigantopelta aegis (peltospirid snail) Pathway gae04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121368011  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gae04121]     121368011    03400 DNA repair and recombination proteins [BR:gae03400]     121368011 Ubiquitin system [BR:gae04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      121368011    Cul5 complex      121368011 DNA repair and recombination proteins [BR:gae03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121368011 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin PPE-PPW Motif Other DBs NCBI-GeneID:  121368011 NCBI-ProteinID:  XP_041348454 LinkDB All DBs Position 3:38550849..38561073 Genome browser AA seq 121 aa AA seqDB search MDVFLMIRRKKVTIFTDAKETTSLGEVKKIIEGVCKVEPENQKLFKDDQPLSDDHKSLGD YGFTGATARAQAPATIGLAFRQEDGEWENLEIAQLSSPPELPDVMKPQDSSSSHAQEQAA S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttttaatgatcagacgaaagaaggtaaccattttcacagacgctaaagaa acgacatcactaggtgaagtaaagaaaattatagaaggtgtgtgcaaagtggagccagaa aatcaaaagcttttcaaagatgatcagcctttgtcagatgatcataagagtttaggtgac tatggtttcacaggagcaacagccagagcgcaagctccagccacaattggtcttgctttt agacaggaagatggtgaatgggagaatttggaaatagcacagctttcgagtccacctgaa ctaccagacgtgatgaagccacaagactcttcttcttcacatgcacaggaacaagcagct tcataa

DBGET integrated database retrieval system