Gigantopelta aegis (peltospirid snail): 121368827 Help Entry 121368827         CDS       T07458                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism gae  Gigantopelta aegis (peltospirid snail) Pathway gae04137   Mitophagy - animal gae04140   Autophagy - animal gae04144   Endocytosis gae04145   Phagosome gae04148   Efferocytosis Brite KEGG Orthology (KO) [BR:gae00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121368827    04145 Phagosome     121368827    04140 Autophagy - animal     121368827    04137 Mitophagy - animal     121368827    04148 Efferocytosis     121368827  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gae04131]     121368827   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gae04147]     121368827    04031 GTP-binding proteins [BR:gae04031]     121368827 Membrane trafficking [BR:gae04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121368827 Exosome [BR:gae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121368827   Exosomal proteins of other body fluids (saliva and urine)    121368827   Exosomal proteins of colorectal cancer cells    121368827   Exosomal proteins of bladder cancer cells    121368827 GTP-binding proteins [BR:gae04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121368827 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA ATP_bind_1 cobW Motif Other DBs NCBI-GeneID:  121368827 NCBI-ProteinID:  XP_041349507 LinkDB All DBs Position 3:71994476..71995581 Genome browser AA seq 144 aa AA seqDB search TAFSVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLG VAFYRGADCCVLVFDVTMPNTFKSLDSWRDEFLIQASPRDPENFPFVVIGNKIDLENRVV SKCLQIPGNILTPKRNFTRLEIVL NT seq 435 nt NT seq  +upstreamnt  +downstreamnt actgctttcagtgttggaaagacgtcactgatgaaccagtatgtaaacaaaaagttcagt aaccagtacaaagcaacaataggtgcagattttttaacaaaagaagttatggttgatgac agacttgtgacgatgcagatctgggacactgctggtcaagagaggttccagagtttgggc gtggcgttctaccgcggtgcggactgctgtgtgttagtgttcgacgtgaccatgcccaac acattcaagtcactggatagctggagagacgagttcctcattcaagccagcccacgcgac ccagaaaacttcccatttgtagtcattggcaacaaaattgatttggaaaacagagtggta agtaaatgtttacagataccaggaaatatactgacccccaaaagaaactttacaaggctt gaaattgtattgtag

DBGET integrated database retrieval system