Gigantopelta aegis (peltospirid snail): 121388342 Help Entry 121388342         CDS       T07458                                  Name (RefSeq) ADP-ribosylation factor 3-like   KO K07937   ADP-ribosylation factor 1/2 Organism gae  Gigantopelta aegis (peltospirid snail) Pathway gae04144   Endocytosis Brite KEGG Orthology (KO) [BR:gae00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121388342  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gae04131]     121388342   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gae04147]     121388342    04031 GTP-binding proteins [BR:gae04031]     121388342 Membrane trafficking [BR:gae04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     121388342   Arf GTPases and associated proteins    Arf GTPases     121388342  Endosome - Golgi transport     121388342 Exosome [BR:gae04147]  Exosomal proteins   Proteins found in most exosomes    121388342 GTP-binding proteins [BR:gae04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     121388342 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc Ras G-alpha Gtr1_RagA SRPRB Ectoine_synth DUF2754 Csa3_N Motif Other DBs NCBI-GeneID:  121388342 NCBI-ProteinID:  XP_041375574 LinkDB All DBs Position 14:complement(582177..582777) Genome browser AA seq 117 aa AA seqDB search SAGKSTILYKLKLNENVCTVLTIGFNVETVTPVKGVTFTVWDVGGQEKIRRLWEHYYRNT QGLIYVVDSADRARMKEASSELMTICAYPEMTGVPVLVTTKICLNFLKLNFVVYVCV NT seq 354 nt NT seq  +upstreamnt  +downstreamnt tctgcaggcaagtcgaccatactgtacaaactgaagctgaacgagaacgtgtgcacggtc ctaaccatcggcttcaacgtggagaccgtgaccccggtcaagggcgtgaccttcaccgtg tgggacgtcggaggtcaagagaaaatcagacgactctgggaacactactacagaaacact caaggcctcatctacgtcgtcgacagtgccgatcgagctcgaatgaaagaagcgtcttcc gaactgatgaccatctgcgcatatccggaaatgacgggagttccggttcttgtaaccact aagatttgccttaatttccttaagcttaactttgtcgtatatgtttgcgtttga

DBGET integrated database retrieval system