Gambusia affinis (western mosquitofish): 122821253 Help Entry 122821253         CDS       T07758                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf04010   MAPK signaling pathway gaf04137   Mitophagy - animal gaf04140   Autophagy - animal gaf04218   Cellular senescence gaf04371   Apelin signaling pathway gaf04519   Cadherin signaling gaf04625   C-type lectin receptor signaling pathway gaf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122821253 (rras)    04371 Apelin signaling pathway     122821253 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122821253 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122821253 (rras)    04137 Mitophagy - animal     122821253 (rras)   09143 Cell growth and death    04218 Cellular senescence     122821253 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122821253 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122821253 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gaf04147]     122821253 (rras)    04031 GTP-binding proteins [BR:gaf04031]     122821253 (rras) Exosome [BR:gaf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122821253 (rras)   Exosomal proteins of bladder cancer cells    122821253 (rras) GTP-binding proteins [BR:gaf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122821253 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF192 Motif Other DBs NCBI-GeneID:  122821253 NCBI-ProteinID:  XP_043954954 LinkDB All DBs Position LG19:795066..805620 Genome browser AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKVCTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSFHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQHRVISREDAQAFARENKIYYMEASAKNRYHVDEAFMELVKIIRRFQEMESPPPP TQQTGKQNSRGCPCVIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggggaagaagagagattcaaactggtggtggtgggaggcggtggagtggggaag agcgccctgaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatt gaagactcctacaccaaggtgtgcactgtggatgggaaggagactcggctagacattcta gatacagcaggccaggaggagtttggtgccatgagggagcaatacatgcggtctggagaa ggcttcttactggtgtttgctctcaacgaccggggcagttttcatgaggtccagaagttc cacacccagatcctgagggtaaaggaccgagacgactttcccatggtgctggttggaaac aaggctgacctggagcagcatagagtgatctccagggaggatgctcaggcgtttgccaga gagaacaagatctactacatggaagcttctgccaaaaatcgctaccatgtggatgaagct ttcatggagttggtgaagatcatcagacggtttcaggagatggagagtcctcctcctcca actcaacaaactgggaaacagaacagtcgtggctgtccctgtgtcatcctgtag

DBGET integrated database retrieval system