Gambusia affinis (western mosquitofish): 122825512 Help Entry 122825512         CDS       T07758                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism gaf  Gambusia affinis (western mosquitofish) Brite KEGG Orthology (KO) [BR:gaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:gaf03029]     122825512 Mitochondrial biogenesis [BR:gaf03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     122825512 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Inovirus_G7P_2 SPC12 Motif Other DBs NCBI-GeneID:  122825512 NCBI-ProteinID:  XP_043962882 LinkDB All DBs Position LG22:12870617..12871241 Genome browser AA seq 56 aa AA seqDB search MGDVSERTLQVAVVISFAVGFLTGWQANRMRRRFLDWRKKRLQDKLSETQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgggagacgtgtcagagaggactttgcaggttgccgtggtaatttcttttgccgtgggc ttcttgacgggctggcaggccaacagaatgaggaggaggttcctggactggaggaagaag cggctgcaggataaactgtcggagacgcagaaaaagctggacttggcttaa

DBGET integrated database retrieval system