Gambusia affinis (western mosquitofish): 122830948 Help Entry 122830948         CDS       T07758                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf04382   Cornified envelope formation gaf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gaf00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122830948 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122830948 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gaf04147]     122830948 (s100a10b) Exosome [BR:gaf04147]  Exosomal proteins   Exosomal proteins of microglial cells    122830948 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 Nop5_N EF-hand_8 DEK_C Motif Other DBs NCBI-GeneID:  122830948 NCBI-ProteinID:  XP_043972713 LinkDB All DBs Position LG05:17671831..17672977 Genome browser AA seq 99 aa AA seqDB search MTELEKSMESLITVFHRYAKEGGNKTTLSKKELKKLIENELPNFLTTQKNPDTVSCIIKD LDQNKDDELDFEEFVPFVAGLTIACEKHYALHHEKKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgagttggagaaatccatggagtccctgatcacggtgtttcaccgttatgccaag gaaggtgggaataaaacgaccctgagcaagaaggagctgaaaaagctgattgagaatgag ttgcccaacttcttaacaacccagaaaaaccccgacacagtgtcatgcatcatcaaggat ttggaccagaacaaggacgatgagctggactttgaggaatttgttcccttcgtcgctgga ctgacaatcgcctgtgaaaagcattacgctttgcaccacgaaaagaagggcaagaagtga

DBGET integrated database retrieval system