Gambusia affinis (western mosquitofish): 122833155 Help Entry 122833155         CDS       T07758                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf04814   Motor proteins gaf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gaf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122833155 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122833155 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gaf03037]     122833155 (dynll2a)    04812 Cytoskeleton proteins [BR:gaf04812]     122833155 (dynll2a) Cilium and associated proteins [BR:gaf03037]  Motile cilia and associated proteins   Dynein arm    122833155 (dynll2a) Cytoskeleton proteins [BR:gaf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122833155 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  122833155 NCBI-ProteinID:  XP_043976438 LinkDB All DBs Position LG06:27335711..27342035 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaggaaagcggtgatcaagaacgcggacatgtccgaggacatgcagcaggac gccgtggactgtgccacccaggccatggagaagtacaacatagagaaggacattgctgcc tacatcaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgttgggagg aactttggcagctacgtcacccacgagacgaagcattttatttacttttacctgggccag gtggccatcttgctcttcaagtccggctga

DBGET integrated database retrieval system