Gambusia affinis (western mosquitofish): 122833196 Help Entry 122833196         CDS       T07758                                  Name (RefSeq) sperm surface protein Sp17-like   KO K25633   sperm surface protein Sp17 Organism gaf  Gambusia affinis (western mosquitofish) Brite KEGG Orthology (KO) [BR:gaf00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gaf03037]     122833196 Cilium and associated proteins [BR:gaf03037]  Motile cilia and associated proteins   Sperm associated proteins    122833196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RIIa Motif Other DBs NCBI-GeneID:  122833196 NCBI-ProteinID:  XP_043976529 LinkDB All DBs Position LG06:complement(20695878..20696762) Genome browser AA seq 95 aa AA seqDB search MSVPFSNTHLRVPRGFGALLEGLSREVLRDQPDNIPAYAAQYFDKLLKEREESGMDPSEW AARLEDRFYNNHAFKGTETVSHANETATEEADVSK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcagtgcctttttccaacactcacctgagggtacctcgggggtttggggccctctta gagggactgagccgagaggttctccgggaccagccggacaacatccctgcatatgcagcg cagtattttgacaaacttctgaaagaaagagaagaaagtgggatggacccttctgagtgg gcagccaggctggaagacaggttctacaataaccatgctttcaagggtacagagactgtt agtcatgcaaacgaaacagcaacagaggaggccgacgtttccaagtga

DBGET integrated database retrieval system