Gambusia affinis (western mosquitofish): 122833617 Help Entry 122833617         CDS       T07758                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf04810   Regulation of actin cytoskeleton gaf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gaf00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122833617 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122833617 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  122833617 NCBI-ProteinID:  XP_043977276 LinkDB All DBs Position LG07:17967822..17969714 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggccaggaagatcccgtacagagagagattcatcaagattgggcaaatcgagag tacatagaagtgattacaagcagcattaagaaaattgctgacttcctcaactcgtttgat atgtcttgtcggtctcgtctggccaccctcaacgaaaagttaacagctttggagagaagg attgaatacatagaggccagagtgaccaaaggagagaccctgacctag

DBGET integrated database retrieval system