Gambusia affinis (western mosquitofish): 122835097 Help Entry 122835097         CDS       T07758                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism gaf  Gambusia affinis (western mosquitofish) Brite KEGG Orthology (KO) [BR:gaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gaf03019]     122835097 (mt2)    03029 Mitochondrial biogenesis [BR:gaf03029]     122835097 (mt2) Messenger RNA biogenesis [BR:gaf03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      122835097 (mt2) Mitochondrial biogenesis [BR:gaf03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     122835097 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  122835097 NCBI-ProteinID:  XP_043979778 LinkDB All DBs Position LG08:239314..239947 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGKCNCGDSCTCASCSCKSCKKSCCSCCPSGCSKCASGCVCKGKTCDKGCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgcgactgcgccaagactggaaaatgtaactgcggagattcttgcacctgc gcgagctgctcctgcaaatcctgcaagaaaagctgctgctcttgctgcccatcaggctgc agtaaatgcgcctctggctgcgtgtgcaaagggaagacctgcgacaagggctgctgtcag tga

DBGET integrated database retrieval system