Gambusia affinis (western mosquitofish): 122845354 Help Entry 122845354         CDS       T07758                                  Symbol ins Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism gaf  Gambusia affinis (western mosquitofish) Pathway gaf04010   MAPK signaling pathway gaf04068   FoxO signaling pathway gaf04081   Hormone signaling gaf04114   Oocyte meiosis gaf04140   Autophagy - animal gaf04150   mTOR signaling pathway gaf04810   Regulation of actin cytoskeleton gaf04910   Insulin signaling pathway gaf04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:gaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122845354 (ins)    04068 FoxO signaling pathway     122845354 (ins)    04150 mTOR signaling pathway     122845354 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     122845354 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122845354 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     122845354 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122845354 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122845354 (ins)    04914 Progesterone-mediated oocyte maturation     122845354 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gaf04052]     122845354 (ins) Cytokines and neuropeptides [BR:gaf04052]  Neuropeptides   Unclassified    122845354 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Peptidase_C34 Motif Other DBs NCBI-GeneID:  122845354 NCBI-ProteinID:  XP_043997513 LinkDB All DBs Position LG15:922321..923687 Genome browser AA seq 140 aa AA seqDB search MTSSLFCCSCLQNLSVCLQFSSSMAALWLQSFSLLVLLVVLWPGSQGVAPPQHLCGSHLV DALYLVCGDRGFFYSPKRDVDHLLGFLPSKTGTGSSHGGENEVAELTLKDQMEMMVKRSG IVEQCCHRPCSIFDLQNYCN NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgacctcctctttgttttgctgctcttgtctacagaatctgtccgtgtgtcttcagttc tcctccagcatggcagcactgtggcttcagtccttctctctgctggtcttactggttgta ttgtggcccggctcccagggcgtcgcaccgccgcagcatctatgtggctctcacctggtt gacgctctctacctggtctgtggggacagaggcttcttctacagccccaagagggatgtg gaccatctcctggggttcctcccttcaaagacaggcacagggtcgagtcacggcggtgag aacgaggtggctgagttaaccttaaaggaccagatggagatgatggttaagaggtcaggc atcgtcgagcagtgctgccacaggccctgcagtatctttgacctgcagaactactgcaac taa

DBGET integrated database retrieval system