Candidatus Gromoviella agglomerans: Gromo_00098 Help Entry Gromo_00098       CDS       T07728                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gagg  Candidatus Gromoviella agglomerans Pathway gagg01100   Metabolic pathways gagg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gagg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gromo_00098    00074 Mycolic acid biosynthesis     Gromo_00098   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gromo_00098 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  UFX98217 LinkDB All DBs Position complement(115262..115537) Genome browser AA seq 91 aa AA seqDB search MNPCAYSEEDIKAKVIEIVRSKLSVDPGVNISDDTNFVNDLGADSLDSVELIMEIEKSFD IEIGDEIAKNITSIKGTIDAISSRLSEKNAT NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaatccttgtgcgtattcagaagaagatatcaaggcaaaggtaatcgaaatagttcga tctaagctttctgtagatcctggagtcaacatatcggacgatactaattttgtgaatgat ttaggtgcagatagtttggattctgttgagttgataatggaaatagaaaaaagttttgat attgaaataggggatgaaattgcaaagaatattacatcaattaaaggaacaattgatgcg atctcgtctagattatcagagaaaaatgcaacttag

DBGET integrated database retrieval system