Geoglobus ahangari: GAH_00890 Help Entry GAH_00890         CDS       T03939                                  Name (GenBank) archaeal histone   KO K24450   DNA-binding protein Organism gah  Geoglobus ahangari Brite KEGG Orthology (KO) [BR:gah00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gah03036]     GAH_00890 Chromosome and associated proteins [BR:gah03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     GAH_00890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TFIID-31kDa CENP-T_C Bromo_TP CENP-S TFIID_20kDa TAF TFIID-18kDa DUF1931 TIP49_C Motif Other DBs NCBI-ProteinID:  AKG91782 UniProt:  A0A0F7IIG8 LinkDB All DBs Position complement(752778..752981) Genome browser AA seq 67 aa AA seqDB search MAELPLAPIDRLIRKAGAERVSEDAVEKMAEVLEEYALQVAKKAVEIAKHANRKTVKAED IKLALSM NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcggagttgccacttgcaccaattgacagattgataaggaaggcaggtgctgagaga gtaagtgaggatgctgtcgagaagatggctgaggtcctcgaggagtacgcacttcaggtc gccaagaaggctgtcgagattgcgaagcacgcaaacaggaagacggtcaaggccgaggac atcaagctcgctctcagcatgtaa

DBGET integrated database retrieval system