Geoglobus ahangari: GAH_00928 Help Entry GAH_00928         CDS       T03939                                  Name (GenBank) Thioredoxin domain   KO K03676   glutaredoxin 3 Organism gah  Geoglobus ahangari Brite KEGG Orthology (KO) [BR:gah00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gah03110]     GAH_00928 Chaperones and folding catalysts [BR:gah03110]  Protein folding catalysts   Protein disulfide isomerase    GAH_00928 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin_3 DUF1525 Glutaredoxin DSBA DUF1223 Glrx-like Thioredoxin_2 Thioredoxin_4 TraF Thioredoxin TXD17-like_Trx SACK1 DUF2119 Motif Other DBs NCBI-ProteinID:  AKG91744 UniProt:  A0A0F7IIE0 LinkDB All DBs Position complement(780783..781043) Genome browser AA seq 86 aa AA seqDB search MITIKLLTSPTCPYCPRAREVVRRFVEEEKDVMALELSVTTDEGLREAMRFGISGVPALI INDRDVLLGVPSISELRRLVSRYKYN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgatcacgataaagctcctcacgtccccaacctgtccgtactgcccgagagcgagggaa gtcgtcaggaggtttgttgaggaggaaaaggacgtcatggcgctcgagctgagcgtcacg acagatgagggattgagagaggcgatgaggttcgggatctcgggagtgccagccctgata ataaacgacagggacgtgctccttggagtcccgagcatctccgagctgagaaggctcgtt agcaggtacaaatacaactga

DBGET integrated database retrieval system