Geoglobus ahangari: GAH_01875 Help Entry GAH_01875         CDS       T03939                                  Name (GenBank) Ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism gah  Geoglobus ahangari Pathway gah03010   Ribosome Brite KEGG Orthology (KO) [BR:gah00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GAH_01875   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GAH_01875  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:gah03011]     GAH_01875    04121 Ubiquitin system [BR:gah04121]     GAH_01875   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gah04147]     GAH_01875 Ribosome [BR:gah03011]  Ribosomal proteins   Eukaryotes    Small subunit     GAH_01875   Archaea     GAH_01875 Ubiquitin system [BR:gah04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GAH_01875 Exosome [BR:gah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GAH_01875   Exosomal proteins of colorectal cancer cells    GAH_01875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_Ribbon_1 Lar_restr_allev Zn_ribbon_Nudix DZR_2 MqsA_antitoxin Zn_ribbon_RPB9 GFA DZR Cas12f1-like_TNB DUF1451 Zn_ribbon_11 IBR_1 Zn_ribbon_NUD Zn_ribbon_IS1595 Zn_ribbon_NOB1 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  AKG90848 UniProt:  A0A0F7IDX2 LinkDB All DBs Position 1606096..1606269 Genome browser AA seq 57 aa AA seqDB search MAKGKKGEVLVSKFYEIKGDKVVRTRKFCPRCGEGVFLAEHKDRRTCGRCGYTEFKK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggcgaagggcaagaagggtgaggttctcgtgtcaaagttctacgagatcaagggagac aaggttgtcagaacgaggaagttctgtccgaggtgcggcgagggagttttcctcgcagag cacaaggacaggagaacctgcggaaggtgcgggtatactgagttcaagaaatga

DBGET integrated database retrieval system