Granulosicoccus antarcticus: IMCC3135_05270
Help
Entry
IMCC3135_05270 CDS
T04938
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
gai
Granulosicoccus antarcticus
Pathway
gai00770
Pantothenate and CoA biosynthesis
gai01100
Metabolic pathways
gai01240
Biosynthesis of cofactors
Module
gai_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
gai00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
IMCC3135_05270 (coaD)
Enzymes [BR:
gai01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
IMCC3135_05270 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
ASJ71167
UniProt:
A0A2Z2NU44
LinkDB
All DBs
Position
1228384..1228887
Genome browser
AA seq
167 aa
AA seq
DB search
MRVTAVYPGTFDPMTVGHIDVARRASGMFDDLVVAVAASTTKSPFFSLEERVDMATEILA
DLENVTVQSFGGLLVDYAGELGSKVIVRGLRAISDFEYEVQIAGVNRHLSPEIETVFIAA
SQEYTFLSSSIVREIARMQGDVSEFVHPIVIDSFARRHRLALHEGNN
NT seq
504 nt
NT seq
+upstream
nt +downstream
nt
atgcgagttactgccgtttatcctggcacttttgacccaatgaccgttggccatatagac
gttgcccgtcgtgcaagtggcatgtttgatgacctggtcgtcgctgttgctgccagcacc
accaaaagtccctttttctcattggaagagcgggtcgacatggcaacggagatactggct
gacctggaaaatgtcaccgttcagtcatttggaggcctgttggtcgactatgcaggcgaa
ttgggcagcaaggtcattgtccggggcttgcgtgccatttccgatttcgaatatgaagtg
cagatcgctggtgtcaatcgccatctgtcccccgaaattgagaccgtgttcatcgccgcc
tcgcaggaatacacttttttatcatccagcatcgttcgagagattgcccgtatgcagggg
gatgtgagcgagtttgtacatccgattgttatcgattcttttgcgagacgtcatcgactt
gctttgcatgagggtaataactga
DBGET
integrated database retrieval system