Granulosicoccus antarcticus: IMCC3135_23235
Help
Entry
IMCC3135_23235 CDS
T04938
Symbol
opuCA
Name
(GenBank) Carnitine transport ATP-binding protein OpuCA
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
gai
Granulosicoccus antarcticus
Pathway
gai02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
gai00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
IMCC3135_23235 (opuCA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
gai02000
]
IMCC3135_23235 (opuCA)
Enzymes [BR:
gai01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
IMCC3135_23235 (opuCA)
Transporters [BR:
gai02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
IMCC3135_23235 (opuCA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
SMC_N
AAA_21
AAA_29
nSTAND1
AAA_16
RsgA_GTPase
DUF2813
AAA_22
NACHT
AAA_5
MMR_HSR1
bpMoxR
ORC-CDC6-like
nSTAND3
AAA_25
Mg_chelatase
AAA_23
FtsK_SpoIIIE
Cytidylate_kin
AAA_28
YobI-ATPase
Zeta_toxin
AAA_15
Motif
Other DBs
NCBI-ProteinID:
ASJ74716
UniProt:
A0A2Z2NT90
LinkDB
All DBs
Position
complement(5285176..5285940)
Genome browser
AA seq
254 aa
AA seq
DB search
MSLRLGQVGVTYNDGTPALDDICLTIDRQEQVALIGPSGSGKSSLLRIMSMALAPSTGSV
ALDEQDPWQQKTARLQRMRGKIHLCPQSAPLPARQRVALAVLSGLLPTRSLAFALRSLMF
PARADVELAHGFLSSLDVEQHLWRPVETLSGGQKQRVAIARAMACEAEYLFVDEPLSALD
PSSSELCLSTLLNHVTQNSQSIVCSLHQVELARSHLSRIIGLRQGRVLFDLPAEDVDEPM
IESLYRGYESELRD
NT seq
765 nt
NT seq
+upstream
nt +downstream
nt
ttgagcctcagactgggtcaggttggtgtcacctacaatgacgggacaccggcactggat
gacatctgcctgaccattgatcgccaggagcaggtggctctgatcggccccagtggttct
ggcaagagctccttgttgcggatcatgagcatggcgcttgcaccgtcaaccggtagcgtg
gcgctcgacgagcaggatccctggcagcagaaaaccgcccgtttgcaacggatgcgcggc
aagattcatctctgcccgcaatcggcgcctctaccagctaggcaacgagtcgcactggcg
gtcttgtccggactattgccaacacgttcgttggcatttgctttgcgctcgctgatgttc
ccagcccgcgcagatgtcgagctggcgcatggttttctgtcaagccttgatgttgagcag
cacttgtggcgacctgttgagaccttgtccggtggacaaaagcaacgggttgccattgct
cgggccatggcttgtgaagccgaatatctgttcgtcgatgaaccactgtcagcgctggac
ccttccagctccgagctgtgtctgagtactttgctgaatcatgtgactcaaaacagccag
tccattgtgtgctctttgcatcaggtcgaactggcgcgtagtcatttgtctcgcatcatc
ggtttacggcagggccgagtgctgtttgatctgccagcagaggatgtcgatgagccgatg
atcgagtccctgtaccgaggctatgagtctgaactccgggattga
DBGET
integrated database retrieval system