Granulosicoccus antarcticus: IMCC3135_34040 Help Entry IMCC3135_34040    CDS       T04938                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gai  Granulosicoccus antarcticus Pathway gai01100   Metabolic pathways gai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IMCC3135_34040 (acpP_3)    00074 Mycolic acid biosynthesis     IMCC3135_34040 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IMCC3135_34040 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  ASJ76848 UniProt:  A0A2Z2P3A1 LinkDB All DBs Position 7737358..7737627 Genome browser AA seq 89 aa AA seqDB search MNTSTDLTLELKRVIIETLELEDITPEDINADEPLFGEGLGLDSIDALELGLMLQKRYGI KLNAESDDTHRHFSSLNALRALVESQREK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacacatcgaccgacctgacgcttgagctaaagcgcgtcatcatcgagacattggaa ctcgaagatattacgccagaagatatcaatgcggatgagccccttttcggagaaggactc ggcctggactccattgacgctctagaattgggtctgatgctgcagaaacgctacggcatt aaactgaacgccgagtcggatgatacccatcgtcatttttccagcctgaacgcattgcga gcgctggtggagtcacagcgtgaaaaatag

DBGET integrated database retrieval system