Glycocaulis alkaliphilus: X907_0813 Help Entry X907_0813         CDS       T05786                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gak  Glycocaulis alkaliphilus Pathway gak01100   Metabolic pathways gak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     X907_0813    00074 Mycolic acid biosynthesis     X907_0813   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     X907_0813 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZU03357 UniProt:  A0A3T0E803 LinkDB All DBs Position 843345..843581 Genome browser AA seq 78 aa AA seqDB search MSDVFDRVKKIVIEHLDVEEDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFISEKVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgtttttgatcgcgttaagaagatcgtcatcgaacatctcgatgtggaagag gataaagtcaccgagaaagcctctttcatcgatgatcttggcgcggactcgctggacaat gtcgagctggtcatggctttcgaggaagagttcgacatcgaaattcccgatgacgcagcc gagcacatccagaccgttggtgatgcggtgaaattcatctccgagaaagtcggctag

DBGET integrated database retrieval system