KEGG   Glycocaulis alkaliphilus: X907_1650
Entry
X907_1650         CDS       T05786                                 
Name
(GenBank) ABC glutamate/glutamine/aspartate/asparagine transporter, periplasmic substrate-binding protein
  KO
K09969  general L-amino acid transport system substrate-binding protein
Organism
gak  Glycocaulis alkaliphilus
Pathway
gak02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gak00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    X907_1650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gak02000]
    X907_1650
Transporters [BR:gak02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   General L-amino acid transporter
    X907_1650
SSDB
Motif
Pfam: SBP_bac_3 NMT1
Other DBs
NCBI-ProteinID: AZU04182
UniProt: A0A3T0EA67
LinkDB
Position
complement(1715283..1716344)
AA seq 353 aa
MTPTAFFDFLMPRRLARAATAFALGFTVSQSQTAELGTQMYELRERGTLRCGVDTGLQGF
ARQDEEGNWNGFEVDLCRAYAAAFLGSPERMQLVPLTTQERLDALSAGEVDILLRNTTWT
LSRDAQENFSFAGVYYYDGQGFLVPRDLGVTSARELDGARICVLRNTTTALNLVDYAQTH
ELTFQLVEVATVRAGITAYGRGQCDALSNDLSGLAGMRMTLSEPDAHLILPDVISKEPLS
AVVASRDQKFADAVRWVLHALIAAEEYGVTAANAAEMAENGGNAEIRRLLGAEGPLAEGL
FLDAEFALRAIEAGGNYGELFERHLGTASGLNLRRGLNAQWNEGGLMYAPPFR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgacgccaacagctttcttcgactttctcatgccgcgccgcctcgcgcgcgctgcaacg
gcctttgcgctgggctttaccgtatcgcaaagccagaccgccgagcttggcacgcagatg
tatgagttgagggagcgcggcacgctgcgatgcggcgtcgataccgggcttcagggcttt
gcccggcaggatgaagagggcaactggaacggtttcgaggtcgatctgtgccgcgcctat
gcggccgctttcctcggcagcccggagcgtatgcagcttgtgccgctgaccacacaggag
aggctggacgcgctgtcggcgggcgaggtcgacatccttctgcgcaatacgacctggacg
ctgagccgcgatgcgcaggaaaatttctcgttcgcaggcgtctattattatgacgggcag
ggctttctggtgccgcgcgatcttggcgtcaccagtgcgcgggaactggacggcgcgcgc
atctgtgttttgcgcaacaccaccacagcgttgaacctcgttgattacgcccagacccat
gagctgaccttccagctggtggaagtggcgacggtccgagccgggataaccgcctatggg
cgcggccagtgcgatgcgctgagcaatgacctgtccggccttgccggcatgcgcatgacg
ctgtctgaaccggatgcgcacctgatccttccggatgtgatctcgaaggagcctctgagc
gcggtcgtcgcctcacgcgaccagaaattcgcggatgccgtgcgctgggtgctccatgcc
ctcattgcggccgaggagtatggcgtgacggccgccaatgcggccgaaatggccgaaaat
ggcggcaatgccgaaatccgccgcctgctgggcgcggaaggtccgctggccgagggcctg
ttcctcgatgcggaattcgcgctgcgggccatcgaggcaggcggcaattatggcgaattg
ttcgagcgtcatctcggcacggcgtccggcctgaatttgcgccggggccttaacgcacag
tggaatgagggcgggctgatgtatgccccgccgttccgttaa

DBGET integrated database retrieval system