Glycocaulis alkaliphilus: X907_2877
Help
Entry
X907_2877 CDS
T05786
Name
(GenBank) feruloyl-CoA synthetase
Organism
gak
Glycocaulis alkaliphilus
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AMP-binding
AMP-binding_C
AMP-binding_C_3
Motif
Other DBs
NCBI-ProteinID:
AZU05384
UniProt:
A0A3T0EDL6
LinkDB
All DBs
Position
complement(2981481..2983052)
Genome browser
AA seq
523 aa
AA seq
DB search
MIDAGKLVSMADVVRQQARVNGTVAAQIFQDRTTSYAALDGHASRVANGLVALGCEPGMR
IGHLGKNSDYFAELLFGAAKARCVLTGVNWRLAGPEILFILKDAGVTTLFVDAEYYPLVE
SLLPALPSLRTVIALDGGHGKWKGYTGWRDSQSGTDPMLKTDPKEDVLQLYTSGTTGNPK
GVVLSHGAYLSLFEQGLKDGFVRWEPGDPNLIAMPYFHVAGTNWALLGFYQAATNIIVKE
VDPVAILDLIEQHKVQTSFFVPAVILFLVQASAAKPRDFSSLRLVAYGASPIAEELLLKA
AKVFDCGFLQFYGLTETNGAAVHLPPADHDPARGKLRAAGKPNAGIEIRVAGEDGKPAPQ
GEVGEVWIRGTSLMTGYWKRPDATAEAINSDGWFKSGDAGYLDKDGYLFIHDRVKDMIIS
GGENIYPAEVENALFSHPGVADVAVIGVPDERWGEAVKAIVVKAPGSDVTPEALIAHARE
RIAAYKVPKSVDFIDALPRNPTGKILKRVLREPYWKGRDRAVS
NT seq
1572 nt
NT seq
+upstream
nt +downstream
nt
atgattgatgcgggcaagctcgtatccatggccgatgtcgtgcgccagcaggcgcgcgtg
aacggcacagtagcggcgcagatattccaggatcgcacgaccagctatgcggcgttggat
ggccacgccagccgggtggccaatgggctggtcgcgctggggtgcgagccgggcatgcgc
atcggccatctgggcaagaatagcgattatttcgccgagcttctttttggcgcggccaag
gcgcgatgcgtgctgacgggcgtgaactggcgcctcgccgggccggaaatcctcttcatc
ctgaaggatgcgggcgtcaccacgctgtttgttgatgccgaatactaccctctggtagag
agccttctgcctgctctgccttcgcttcgcacggtcatcgcgctcgatggcgggcatggc
aagtggaagggctataccggctggcgggacagccagtccggcaccgatccgatgctgaag
acggacccgaaagaggatgtgctccagctctacacatccggcacgacgggcaacccgaag
ggcgtggtgctctcgcacggcgcgtatctctcgctcttcgagcagggtctgaaggacggg
tttgtgcggtgggagccgggcgatccgaacctcatcgccatgccctatttccacgtggcg
ggcacgaactgggcgctcctgggcttctatcaggcggcgacgaatatcatcgtcaaggaa
gttgatccggtcgcgatccttgatctcatcgaacagcacaaggtccagaccagcttcttc
gtgccagccgtgatcctgtttctggtgcaggccagcgcggcgaaaccgcgcgatttttct
tcgctcaggcttgttgcctatggcgcctcgccgattgcggaagaattgctgctcaaagcg
gccaaggttttcgattgcggttttctgcagttctacggccttaccgagaccaatggcgcg
gcggtgcatttgccgccggctgatcatgatccggcgcgcggcaagctgcgcgcagcgggc
aaacccaatgccggtatcgagatccgtgtcgcgggcgaggatggcaagccggccccgcaa
ggcgaggtgggcgaggtgtggatacgcggcaccagcctgatgacaggctattggaaacgg
cccgatgccacggcagaggcgatcaattccgatggctggttcaagtccggcgatgcgggc
tatctcgacaaggatggctatctcttcatccatgaccgggtgaaggacatgatcatttcc
ggcggcgagaatatctacccggcggaagtggaaaatgcgctcttctcccatccgggcgtg
gccgatgtggccgtgatcggtgtgccggacgagcgctggggcgaggcggtgaaggcgatt
gtcgtgaaggcgcccggatcagatgtgacgccggaagccctgatcgcgcatgcgagggag
cgcatcgccgcctacaaggtgcccaaaagcgtggatttcattgacgctttgccgcgcaat
ccgaccggcaagatcctcaagcgcgttcttcgggaaccgtactggaaggggcgcgaccgg
gcggtgagctag
DBGET
integrated database retrieval system