Gluconobacter albidus: A0U94_04395 Help Entry A0U94_04395       CDS       T04736                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gal  Gluconobacter albidus Pathway gal01100   Metabolic pathways gal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U94_04395    00074 Mycolic acid biosynthesis     A0U94_04395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U94_04395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AQS90328 UniProt:  A0A149TDT5 LinkDB All DBs Position complement(987936..988190) Genome browser AA seq 84 aa AA seqDB search MTDSVTDISAMIIEKLLANPKVPRDIDGNSKIVEDLAFDSLAVMNFVMEIEDEIDVSVPL DKLADIRTINDLAGCLHALKVAQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactgacagcgtcaccgacatttccgcaatgatcattgagaaactgcttgccaacccg aaagttccccgggacattgatggcaacagcaagattgtcgaagatcttgcctttgacagc ctggccgtcatgaatttcgttatggaaatcgaagacgaaatcgacgtctccgtccctctc gacaaactggctgatatccgcaccatcaatgatctggccggctgcctgcatgcgctgaaa gtcgcccaggcgtga

DBGET integrated database retrieval system