KEGG   Gluconobacter albidus: A0U94_09180
Entry
A0U94_09180       CDS       T04736                                 
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gal  Gluconobacter albidus
Pathway
gal00061  Fatty acid biosynthesis
gal00620  Pyruvate metabolism
gal00640  Propanoate metabolism
gal00720  Other carbon fixation pathways
gal01100  Metabolic pathways
gal01110  Biosynthesis of secondary metabolites
gal01120  Microbial metabolism in diverse environments
gal01200  Carbon metabolism
gal01212  Fatty acid metabolism
Module
gal_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0U94_09180
   00640 Propanoate metabolism
    A0U94_09180
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    A0U94_09180
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A0U94_09180
Enzymes [BR:gal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     A0U94_09180
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A0U94_09180
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp Oxidored_nitro ATP-grasp_3 AIRC
Other DBs
NCBI-ProteinID: AQS91121
LinkDB
Position
complement(2021105..2022457)
AA seq 450 aa
MISKVLIANRGEIALRIQRACREMGIKTVAVHSTADADAMHVRLADEAVCIGPPSARDSY
LNVAAILSAATITGADAIHPGYGFLSENAEFAETVEEHGLAFIGPTAEHIRTMGDKIAAK
TTMRALGVPLVPGSDGGLANLQAAREVAEKVGYPVLIKAAAGGGGRGMKVAMTADDLEEA
WSVARAEARAAFGNDEVYLEKYLNRPRHIELQILGDAHGNVVHFGERDCSLQRRHQKLLE
EAGSPALTDAEREQIGRTATEALSRMGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTE
MVCNVDLVREQIRIASGEPLGYTQSDIKMSGHAIECRINAEDPETFMPSPGTIKVFHAPG
GLGVRMDSAIYAGYRIPPYYDSMIAKLIVHAPTRAEAIARMQRALDECVVDGVKTVIPLH
QKILADPSFQKGDYTIHWLENFVAARQAGK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgatttccaaggtcctcattgccaaccggggtgagatcgcgctgcggatccagcgcgcc
tgccgcgagatgggcatcaaaaccgttgccgtgcattcgacggcagacgccgatgcgatg
catgtgcgtcttgcggacgaagccgtctgcatcggtccgccgagtgcgcgcgactcctat
ctgaacgttgcagctattctttccgctgcgacgatcacaggggctgacgccattcacccc
ggctatggcttcctgtcggaaaatgccgagttcgccgaaaccgtggaagaacacggtctc
gcgtttatcggcccgaccgccgagcatatccgcacgatgggcgacaagatcgccgccaag
accaccatgcgggcgctcggtgtgccgctggtgcccggctccgatggcggtctggcaaat
ttacaggctgcccgtgaggttgcggaaaaagtcggctatccggttctcatcaaggctgct
gccggtggtggcgggcgcggaatgaaggtcgcaatgacggcggacgaccttgaggaagcc
tggtcggtggcccgtgccgaagcccgtgcggctttcggcaacgacgaggtctatctcgag
aaatatctcaaccgtccgcgtcacatcgagcttcagatccttggcgatgcgcatggcaat
gtcgtgcatttcggcgagcgtgactgttcgctccagcgccgtcaccagaagcttctggaa
gaagccggttcaccggccctgacagatgccgaacgcgaacagatcggccggaccgcgacc
gaggccctctcacgcatgggctatcgcaacgctggcacgctcgagttcctgtatcaggac
ggccagttctgcttcatcgagatgaacacgcgtcttcaggtcgagcacccggtgacggag
atggtctgcaacgtggatctcgttcgcgagcagatccgcatcgcatccggtgagccgctt
ggttacacgcagtcggatatcaaaatgtccgggcatgcgatcgagtgccgcatcaatgcg
gaagatccggaaaccttcatgccgagccccggtacgatcaaggtgttccatgctccgggt
gggctgggcgttcgtatggacagcgccatttacgctggctatcgcatcccgccttactac
gacagcatgatcgccaagctgattgtgcatgcccccacgcgcgctgaagccattgcccgc
atgcagcgtgctctggatgaatgtgtggtggatggtgtgaagacggtcattccgcttcac
cagaaaattctggccgacccttctttccagaagggagactataccattcattggctggaa
aattttgttgctgcccggcaggcaggaaaataa

DBGET integrated database retrieval system