Grus americana (Whooping crane): 129196556 Help Entry 129196556         CDS       T11359                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism game  Grus americana (Whooping crane) Pathway game04010   MAPK signaling pathway game04012   ErbB signaling pathway game04068   FoxO signaling pathway game04137   Mitophagy - animal game04140   Autophagy - animal game04150   mTOR signaling pathway game04210   Apoptosis game04218   Cellular senescence game04370   VEGF signaling pathway game04371   Apelin signaling pathway game04540   Gap junction game04625   C-type lectin receptor signaling pathway game04810   Regulation of actin cytoskeleton game04910   Insulin signaling pathway game04912   GnRH signaling pathway game04916   Melanogenesis Brite KEGG Orthology (KO) [BR:game00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129196556 (NRAS)    04012 ErbB signaling pathway     129196556 (NRAS)    04370 VEGF signaling pathway     129196556 (NRAS)    04371 Apelin signaling pathway     129196556 (NRAS)    04068 FoxO signaling pathway     129196556 (NRAS)    04150 mTOR signaling pathway     129196556 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129196556 (NRAS)    04137 Mitophagy - animal     129196556 (NRAS)   09143 Cell growth and death    04210 Apoptosis     129196556 (NRAS)    04218 Cellular senescence     129196556 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     129196556 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129196556 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129196556 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     129196556 (NRAS)    04912 GnRH signaling pathway     129196556 (NRAS)    04916 Melanogenesis     129196556 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:game04131]     129196556 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:game04147]     129196556 (NRAS)    04031 GTP-binding proteins [BR:game04031]     129196556 (NRAS) Membrane trafficking [BR:game04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129196556 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     129196556 (NRAS) Exosome [BR:game04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129196556 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    129196556 (NRAS)   Exosomal proteins of breast cancer cells    129196556 (NRAS)   Exosomal proteins of colorectal cancer cells    129196556 (NRAS) GTP-binding proteins [BR:game04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129196556 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129196556 NCBI-ProteinID:  XP_054660229 LinkDB All DBs Position 25:2830782..2837862 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccattgaggattcgtat agaaagcaggttgttattgatggagagacgtgcttgttagacattctggacactgcggga caggaagagtacagtgccatgcgtgatcagtacatgagaaccggggaaggattcctctgt gtttttgccattaacaacagtaaatcctttgctgatattaacctttacagagaacagatc aagagagtgaaagattcagatgacgtgccaatggtgctagttgggaataagtgtgatttg cccacaagaacagtagacacgaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacaagacagggtgtggaagacgctttttacacactggtg agagagatccggcagtaccggatgaaaaagctcaacagcaatgaagacgggaatcaaggc tgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system