Grus americana (Whooping crane): 129199079 Help Entry 129199079         CDS       T11359                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism game  Grus americana (Whooping crane) Pathway game04145   Phagocytosis game04814   Motor proteins game05132   Salmonella infection Brite KEGG Orthology (KO) [BR:game00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     129199079 (DYNLT3)   09142 Cell motility    04814 Motor proteins     129199079 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129199079 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:game03037]     129199079 (DYNLT3)    04812 Cytoskeleton proteins [BR:game04812]     129199079 (DYNLT3) Cilium and associated proteins [BR:game03037]  Motile cilia and associated proteins   Dynein arm    129199079 (DYNLT3) Cytoskeleton proteins [BR:game04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129199079 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  129199079 NCBI-ProteinID:  XP_054664825 LinkDB All DBs Position 1:125793637..125802432 Genome browser AA seq 116 aa AA seqDB search MEEFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcacccccacaacgacgagatgatcttcaatgctgatgaggcccacaac atagttaaggagtgcatagaaagtgttttaggcaaggcagattataatcacaacaaagtc aaccagtggactgctgctatagtagaacagtcactgacacatctagtaaaactcggaaaa acatataagtacatcgtaacctgtgcggtgatgcagaggagtggagctggtcttcacaca gcaagctcatgcttctgggataccacaactgatggaacctgcacagtgagatgggaaaac cgaacaatgaactgcattgtcaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system