Grus americana (Whooping crane): 129202110 Help Entry 129202110         CDS       T11359                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism game  Grus americana (Whooping crane) Pathway game03082   ATP-dependent chromatin remodeling game04217   Necroptosis Brite KEGG Orthology (KO) [BR:game00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129202110  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129202110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:game03036]     129202110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:game04147]     129202110 Chromosome and associated proteins [BR:game03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129202110 Exosome [BR:game04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129202110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129202110 NCBI-ProteinID:  XP_054670183 LinkDB All DBs Position 1:54952766..54953200 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcgggaagcagggcgggaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccgcctgctgcgcaagggcaactac gcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccggcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgactatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctgcccaagaag actgagagccacaaagccaagagcaagtaa

DBGET integrated database retrieval system