Grus americana (Whooping crane): 129205254 Help Entry 129205254         CDS       T11359                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism game  Grus americana (Whooping crane) Pathway game04814   Motor proteins game05132   Salmonella infection Brite KEGG Orthology (KO) [BR:game00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     129205254 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129205254 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:game03037]     129205254 (DYNLT1)    04812 Cytoskeleton proteins [BR:game04812]     129205254 (DYNLT1) Cilium and associated proteins [BR:game03037]  Motile cilia and associated proteins   Dynein arm    129205254 (DYNLT1) Cytoskeleton proteins [BR:game04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129205254 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129205254 NCBI-ProteinID:  XP_054678468 LinkDB All DBs Position 3:67312353..67318011 Genome browser AA seq 113 aa AA seqDB search MDDFQSAEETSFVVDEVSSIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccagtcagcggaggagacttcctttgttgttgatgaagttagtagcatc attaaagaggccatagaaagcgcgataggcggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaacactaagccaactcacaaagctggggaagcct ttcaagtatatcgtgacctgtgtgattatgcaaaagaacggtgccgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag actatgtactgtattgtcagtgccttcggacttgcaatataa

DBGET integrated database retrieval system