Grus americana (Whooping crane): 129205612 Help Entry 129205612         CDS       T11359                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism game  Grus americana (Whooping crane) Pathway game04060   Cytokine-cytokine receptor interaction game04218   Cellular senescence game04620   Toll-like receptor signaling pathway game04621   NOD-like receptor signaling pathway game04622   RIG-I-like receptor signaling pathway game05132   Salmonella infection game05164   Influenza A Brite KEGG Orthology (KO) [BR:game00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129205612  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129205612  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129205612    04621 NOD-like receptor signaling pathway     129205612    04622 RIG-I-like receptor signaling pathway     129205612  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     129205612   09171 Infectious disease: bacterial    05132 Salmonella infection     129205612  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:game04052]     129205612    00536 Glycosaminoglycan binding proteins [BR:game00536]     129205612 Cytokines and neuropeptides [BR:game04052]  Cytokines   Chemokines    129205612 Glycosaminoglycan binding proteins [BR:game00536]  Heparan sulfate / Heparin   Chemokines    129205612 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129205612 NCBI-ProteinID:  XP_054679360 LinkDB All DBs Position 4:81847929..81851285 Genome browser AA seq 103 aa AA seqDB search MNGKLVAVLALFLISVAVSQGRTLARMGTELRCQCIATHSKFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAHWVQLIVKAILAKAQLNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaacttgtggctgtcctggctctcttcctgatttcagtggctgtgtcccaa gggaggaccctggcaaggatgggaaccgagctccggtgccagtgcatagccacgcattcc aagttcatcccgcctaaatccatccaagatgtgaagctgacccagagcggcccccactgc aagaacgtcgaagtcatagctactctgaaggacggcagagaggtgtgcttggagcccact gctcactgggttcagctgatcgtgaaggcaattttggccaaggctcaactgaattctgac tcaccgctctaa

DBGET integrated database retrieval system