Grus americana (Whooping crane): 129211396 Help Entry 129211396         CDS       T11359                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism game  Grus americana (Whooping crane) Pathway game04137   Mitophagy - animal game04140   Autophagy - animal game04142   Lysosome biogenesis game04144   Endocytosis game04145   Phagosome game04148   Efferocytosis game05132   Salmonella infection Brite KEGG Orthology (KO) [BR:game00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129211396 (RAB7A)    04145 Phagosome     129211396 (RAB7A)    04142 Lysosome biogenesis     129211396 (RAB7A)    04140 Autophagy - animal     129211396 (RAB7A)    04137 Mitophagy - animal     129211396 (RAB7A)    04148 Efferocytosis     129211396 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129211396 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:game04131]     129211396 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:game04147]     129211396 (RAB7A)    04031 GTP-binding proteins [BR:game04031]     129211396 (RAB7A) Membrane trafficking [BR:game04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129211396 (RAB7A) Exosome [BR:game04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129211396 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    129211396 (RAB7A)   Exosomal proteins of colorectal cancer cells    129211396 (RAB7A)   Exosomal proteins of bladder cancer cells    129211396 (RAB7A) GTP-binding proteins [BR:game04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129211396 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  129211396 NCBI-ProteinID:  XP_054694421 UniProt:  A0A850TFW9 LinkDB All DBs Position 11:13715432..13735650 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatcctcggagactctggggtgggg aagacatcgcttatgaaccagtatgtgaacaagaaattcagtaaccaatacaaggctacg ataggcgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacggcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaacgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system